Domain: kazusa.or.jp

Overview
Ads (0)
PPC Keywords (0)
Organic Keywords (141)
Competitors (926)
Sub-Domains
kazusa.or.jp
Paid Keywords
Keywords found: 0
#Competitors: 0
#Ad Copies: N/A
 
Organic Keywords
Keywords found: 141
#Competitors: 950
Average Position: N/A
 
PPC Overview
No Results Found
Organic Overview
Keywords (141) Position
huge a 6
co don 7
codon 13
codon 12
kazusa 1
ne do 8
codon 16
codon 15
codon 14
kazusa 2
View More »
Competitors (950) Keywords
ncbi.nlm.nih.gov 1,931,895
en.wikipedia.org 28,718,623
linkinghub.elsevier.com 4,514,823
springerlink.com 3,444,879
cat.inist.fr 2,162,817
pubmedcentral.nih.gov 1,319,359
quantcast.com 721,343
osti.gov 248,078
wbparts.com 27,725
nar.oxfordjournals.org 68,099
View More »
Organic Listing Variations
1.
>AY392424#1\AY392424\complement(104..364)\261\AAR05110.1 ...
P200\Rhodococcus sp. P200 rubredoxin (rub1), putative naphthalenedegradation .... gene="narC"/inference="non-experimental evidence, no additional details ...
2.
Lotus japonicus (Chloroplast)
... 0.27 sp|P50890|RSP4_CHICK 40S RIBOSOMAL PROTEIN SA (P40) (34/67 KDA L.. ...... 195 RDAA++KRQLS L+ YLGGIKYMTGLPDIVII+DQ EEYTALRECITLGIPTICLIDTNC Sbjct: ...
3.
Lotus: BLAST2 result
... EREGEGGEEGEGREEAEEEEAEEKEAEEEEAEEAEEEAEEEEAEEAE---AEEEEAEEEE 137 Query: 158 VLPDIVPEVFDEVNDETGIEVQVAESNAENTAENGAEKSPEVAENETENNAE--KEGEKS 215 + E +E +EE ...
4.
Codon Usage Database
Data source. NCBI-GenBank Flat File Release 160.0 [June 15 2007]. ... CUTG: Codon Usage Tabulated from GenBank (ftp distribution) ...
5.
Gene/Protein Characteristic Table for mKIAA0434
Entry, Exp, ID%, Protein, Source. O88737, 0, 95.0, Bassoon protein. Mus musculus. CAA77176, 0, 84.8, Bassoon protein... Homo sapiens ...
6.
>AB088799\AB088799\1..1548\1548\BAD20593.1\chloroplast Zingiber ...
>AB088799\AB088799\1..1548\1548\BAD20593.1\chloroplast Zingiber gramineum\Zingiber gramineum chloroplast matK gene for maturase, completecds. ...
7.
>EF520287#1\EF520287\451..1653\1203\ABR68675.1\KI polyomavirus\KI ...
>EF520287#1\EF520287\451..1653\1203\ABR68675.1\KI polyomavirus\KI polyomavirus isolate Brisbane 001, complete genome. ...
8.
>AB162908#1\AB162908\2656..3621\966\BAF43979.1\mitochondrion ...
>AB162908#1\AB162908\2656..3621\966\BAF43979.1\mitochondrion Lepidophyma flavimaculatum\Lepidophyma flavimaculatum mitochondrial DNA, complete genome. ...
9.
Medicago: BLAST2 result
... Positives = 36/58 (61%), Gaps = 14/58 (24%) Query: 61 CLN----KIKISANGRSVVAKVVDECDSRAGCDKEHDYQPPCNNNIVDASKAVWKALG 114 CLN K++I+ G +VA VVDECDSR GC +++VD+S ...
10.
>DQ990721\DQ990721\1..1137\1137\ABM69233.1\mitochondrion ...
>DQ990721\DQ990721\1..1137\1137\ABM69233.1\mitochondrion Herichthys bartoni\Herichthys bartoni isolate 2895MEX cytochrome b (cytb) gene,complete cds; ...
 
View More »
ascSort Ascending
descSort Descending
eqEquals...
!eqDoes Not Equal...
gtGreater Than...
gteqGreater Than or Equal To...
ltLess Than...
lteqLess Than or Equal To...
      And   Or
                
Sometimes you don’t know exactly what you are looking for in a Research data. That’s when our searching options may come handy.
The Domain Search
This search allows you to enter the domain name of the site you want to analyze. For example, you may enter “amazon.com” in the KeywordSpy search bar.

The Keyword Search
This will let you enter terms and key phrases in the search bar such as “send flowers”, “cover letters”, “keyword software,” and even a single broad term like “chocolate”.

The Ad Copy Search
This allows you to enter any texts or content included in an ad copy, whether the ones in ad copy headline or the ones in description lines. For example: “sunglasses”.
The Destination URL Search
This search allows you to enter the destination URL of the site that you want to analyze.

The destination URL is the address where a searcher is taken when an advertisement copy in search engines is clicked. Please take note that the destination URL differs from the display URL which appears at the bottom of advertisement copies.

Please be reminded to always include http:// at the beginning of your Destination URL search. For example: “http://www.proflowers.com”.

In addition, if you want to find all the ads that KeywordSpy indexed for a specific affiliate network e.g. Hydra Network. You should search in Destination URL the string lynxtrack.com.
Loading
  Loading...