Overview
Ads (0)
PPC Keywords (0)
Organic Keywords (0)
Competitors (122)
Sub-Domains
bridgeurbanwinery.com
Paid Keywords
Keywords found: 0
#Competitors: 0
#Ad Copies: N/A
 
Organic Keywords
Keywords found: 0
#Competitors: 131
Average Position: N/A
 
PPC Overview
No Results Found
Organic Overview
Keywords (0) Position
   
   
   
   
   
   
   
   
   
   
View More »
Competitors (131) Keywords
parishiltonautopsy.com 95
sfgate.com 545,478
caplakesting.com 1,095
youtube.com 30,834,319
artfagcity.com 2,548
wine.appellationamerica.com 25,958
napavalley.com 7,174
ironbridgewines.com 150
adirondackwinery.com 18
familywineriesdrycreekvalley.com 91
View More »
Organic Listing Variations
1.
bridge urban winery
wine cl. contact. press. bridget. menu. hours. tasting notes. ... first shipment goes out in october wine club memberships make great gifts! we ask that ... Show map of 4210 Holland Loop Rd, Cave Junction, OR 97523
2.
Bridge Urban Winery - Tasting Notes
blanc de blancs (nv) sparkling wine made from chardonnay grapes in the ... 2006 chardonnay aged 11 months in french oak. bright flavors of green apple ...
3.
The Cheap List - Cheap Eats 2008 -- New York Magazine
New York Magazine. Skip to content, or skip to search. ... Among today’s cheap-eats sophisticates, a bar crawl is just as likely to require good food as it is drink. ... the best use of sea-urchin roe that doesn’t require silverware. ...
4.
bridge urban winery
bridge vineyards. wine club. first shipment goes out in october wine ... bridge vineyards. menu. menu. food pairings - local seasonal menu changes daily ... Show map of 4210 Holland Loop Rd, Cave Junction, OR 97523
5.
bridge urban winery
wine cl. contact. press. bridget. menu. hours. tasting notes. ... first shipment goes out in october wine club memberships make great gifts! we ask that ... Show map of 4210 Holland Loop Rd, Cave Junction, OR 97523
6.
bridge urban winery
bridge vineyards. wine club. first shipment goes out in october wine ... bridge vineyards. menu. menu. food pairings - local seasonal menu changes daily ... Show map of 4210 Holland Loop Rd, Cave Junction, OR 97523
7.
The Cheap List - Cheap Eats 2008 -- New York Magazine
Among today’s cheap-eats sophisticates, a bar crawl is just as likely to require good .... FROM BROOKLYN BRIDGE TO LONDON BRIDGE... - London Bridge Hotel ...
8.
bridge urban winery
The Tasting Room · Redacted Recipes ... New York magazine, Restaurant Openings. bridge vineyards. press. press. contact. press. bridget. menu. tasting notes ... Show map of 4210 Holland Loop Rd, Cave Junction, OR 97523
9.
bridge urban winery
The Tasting Room · Redacted Recipes ... New York magazine, Restaurant Openings. bridge vineyards. press. press. contact. press. bridget. menu. tasting notes ... Show map of 4210 Holland Loop Rd, Cave Junction, OR 97523
10.
bridge urban winery
bridge vineyards. wine club. first shipment goes out in october wine ... bridge vineyards. menu. menu. food pairings - local seasonal menu changes daily ... Show map of 4210 Holland Loop Rd, Cave Junction, OR 97523
 
View More »
ascSort Ascending
descSort Descending
eqEquals...
!eqDoes Not Equal...
gtGreater Than...
gteqGreater Than or Equal To...
ltLess Than...
lteqLess Than or Equal To...
      And   Or
                
Sometimes you don’t know exactly what you are looking for in a Research data. That’s when our searching options may come handy.
The Domain Search
This search allows you to enter the domain name of the site you want to analyze. For example, you may enter “amazon.com” in the KeywordSpy search bar.

The Keyword Search
This will let you enter terms and key phrases in the search bar such as “send flowers”, “cover letters”, “keyword software,” and even a single broad term like “chocolate”.

The Ad Copy Search
This allows you to enter any texts or content included in an ad copy, whether the ones in ad copy headline or the ones in description lines. For example: “sunglasses”.
The Destination URL Search
This search allows you to enter the destination URL of the site that you want to analyze.

The destination URL is the address where a searcher is taken when an advertisement copy in search engines is clicked. Please take note that the destination URL differs from the display URL which appears at the bottom of advertisement copies.

Please be reminded to always include http:// at the beginning of your Destination URL search. For example: “http://www.proflowers.com”.

In addition, if you want to find all the ads that KeywordSpy indexed for a specific affiliate network e.g. Hydra Network. You should search in Destination URL the string lynxtrack.com.
Loading
  Loading...